Protein Info for OHPLBJKB_04295 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: HTH-type transcriptional repressor NanR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF00392: GntR" amino acids 18 to 77 (60 residues), 67.5 bits, see alignment E=9.5e-23 PF08279: HTH_11" amino acids 42 to 66 (25 residues), 21.2 bits, see alignment (E = 3.2e-08) PF07729: FCD" amino acids 108 to 226 (119 residues), 75.4 bits, see alignment E=8.4e-25

Best Hits

Swiss-Prot: 100% identical to YIEP_ECOLI: Uncharacterized HTH-type transcriptional regulator YieP (yieP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3755)

Predicted SEED Role

"Transcriptional regulator, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>OHPLBJKB_04295 HTH-type transcriptional repressor NanR (Escherichia coli HS(pFamp)R (ATCC 700891))
MPLSAQQLAAQKNLSYVLAEKLAQRILKGEYEPGTILPGEIELGEQFGVSRTAVREAVKT
LTAKGMVLPRPRIGTRVMPQSNWNFLDQELLTWWMTEENFHQVIDHFLVMRICLEPQACL
LAATVGTAEQKAHLNTLMAEMAALKENFRRERWIEVDMAWHEHIYEMSANPFLTSFASLF
HSVYHTYFTSITSDTVIKLDLHQAIVDAIVQSDGDAAFKACQALLRSPDT