Protein Info for OHPLBJKB_04214 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Sec-independent protein translocase protein TatB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01410: twin arginine-targeting protein translocase TatB" amino acids 2 to 80 (79 residues), 108 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 100% identical to TATB_SHIFL: Sec-independent protein translocase protein TatB (tatB) from Shigella flexneri

KEGG orthology group: K03117, sec-independent protein translocase protein TatB (inferred from 100% identity to eco:b3838)

MetaCyc: 100% identical to twin arginine protein translocation system - TatB protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatB" in subsystem Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>OHPLBJKB_04214 Sec-independent protein translocase protein TatB (Escherichia coli HS(pFamp)R (ATCC 700891))
MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQ
DSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVANDPEKASDEAHTIHNPVVKDNE
AAHEGVTPAAAQTQASSPEQKPETTPEPVVKPAADAEPKTAAPSPSSSDKP