Protein Info for OHPLBJKB_04125 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Glycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 TIGR01311: glycerol kinase" amino acids 5 to 497 (493 residues), 765.6 bits, see alignment E=8.3e-235 PF00370: FGGY_N" amino acids 6 to 253 (248 residues), 320.5 bits, see alignment E=8.1e-100 PF02782: FGGY_C" amino acids 263 to 451 (189 residues), 156.5 bits, see alignment E=8e-50

Best Hits

Swiss-Prot: 100% identical to GLPK_ECO24: Glycerol kinase (glpK) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K00864, glycerol kinase [EC: 2.7.1.30] (inferred from 100% identity to eco:b3926)

MetaCyc: 100% identical to glycerol kinase (Escherichia coli K-12 substr. MG1655)
Glycerol kinase. [EC: 2.7.1.30]

Predicted SEED Role

"Glycerol kinase (EC 2.7.1.30)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or MLST (EC 2.7.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>OHPLBJKB_04125 Glycerol kinase (Escherichia coli HS(pFamp)R (ATCC 700891))
MTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSST
LVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDG
LEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPI
SGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVN
YALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYAGWKKAVKRAMAWEEHDE