Protein Info for OHPLBJKB_04116 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: 'Primosomal protein N'' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 PF17764: PriA_3primeBD" amino acids 6 to 101 (96 residues), 108 bits, see alignment E=6.3e-35 PF21213: PriA-like_WH" amino acids 114 to 176 (63 residues), 111 bits, see alignment E=7.4e-36 PF04851: ResIII" amino acids 197 to 359 (163 residues), 54.8 bits, see alignment E=3.9e-18 PF00270: DEAD" amino acids 202 to 364 (163 residues), 78.3 bits, see alignment E=2.1e-25 TIGR00595: primosomal protein N'" amino acids 221 to 730 (510 residues), 729.3 bits, see alignment E=1.1e-223 PF18319: PriA_CRR" amino acids 445 to 471 (27 residues), 31.2 bits, see alignment (E = 5.8e-11) PF00271: Helicase_C" amino acids 502 to 589 (88 residues), 30 bits, see alignment E=1.9e-10 PF18074: PriA_C" amino acids 632 to 729 (98 residues), 62.6 bits, see alignment E=1.7e-20

Best Hits

Swiss-Prot: 100% identical to PRIA_ECOLI: Primosomal protein N' (priA) from Escherichia coli (strain K12)

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 100% identity to ecx:EcHS_A4167)

MetaCyc: 100% identical to primosomal protein N' (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (732 amino acids)

>OHPLBJKB_04116 'Primosomal protein N'' transl_table=11 (Escherichia coli HS(pFamp)R (ATCC 700891))
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGVVVSVSDVSELPLNEL
KAVVEVLDVEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFA
TEQGQAVDLNSLKRSPKQQQALAALRQGKIWRDQVATLEFNDAALQALRKKGLCDLASET
PEFSDWRTNYAVSGERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLEN
VLAQGKQALVMVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIV
IGTRSALFTPFKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPA
LETLCNVQQKKYRLLRLTRRAGNARPAIQHVLDLKGQKVQAGLAPALITRMRQHLQADNQ
VILFLNRRGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCG
STHLVPVGLGTEQLEQTLAPLFPGVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQ
MLAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHH
PEHPLLQTLLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLI
LSSPLADEKLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIINGTLALINTIPDSRK
VKWVLDVDPIEG