Protein Info for OHPLBJKB_04058 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Sulfur carrier protein ThiS adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 31 to 57 (27 residues), see Phobius details TIGR02356: thiazole biosynthesis adenylyltransferase ThiF" amino acids 8 to 209 (202 residues), 288.4 bits, see alignment E=1.2e-90 PF00899: ThiF" amino acids 9 to 242 (234 residues), 236.8 bits, see alignment E=8.1e-75

Best Hits

Swiss-Prot: 100% identical to THIF_ECOLI: Sulfur carrier protein ThiS adenylyltransferase (thiF) from Escherichia coli (strain K12)

KEGG orthology group: K03148, adenylyltransferase [EC: 2.7.7.-] (inferred from 100% identity to eco:b3992)

MetaCyc: 100% identical to sulfur carrier protein ThiS adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-9789 [EC: 2.7.7.73]

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>OHPLBJKB_04058 Sulfur carrier protein ThiS adenylyltransferase (Escherichia coli HS(pFamp)R (ATCC 700891))
MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADD
DDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARAD
VVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEP
ERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALRRASGC
PVCGGSNADPV