Protein Info for OHPLBJKB_04054 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: NADH pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09297: zf-NADH-PPase
  • amino acids 93 to 124 (32 residues), 39.6 bits, 3.4e-14
• PF00293: NUDIX
  • amino acids 132 to 240 (109 residues), 71 bits, E=1e-23

Best Hits

Swiss-Prot: 100% identical to NUDC_ECO8A: NADH pyrophosphatase (nudC) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: K03426, NAD+ diphosphatase [EC: 3.6.1.22] (inferred from 100% identity to eco:b3996)

MetaCyc: 100% identical to RNA decapping hydrolase (Escherichia coli K-12 substr. MG1655)
NAD(+) diphosphatase. [EC: 3.6.1.22]; RXN0-7346 [EC: 3.6.1.22]

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

• NAD salvage pathway III (to nicotinamide riboside) (3/3 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
• NAD salvage (plants) (5/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Protein Sequence (257 amino acids)

>OHPLBJKB_04054 NADH pyrophosphatase (Escherichia coli HS(pFamp)R (ATCC 700891))
MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLVQQQ
RRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCR
ERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESG
IKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTV
ARRLIEDTVAMCRAEYE