Protein Info for OHPLBJKB_03963 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Proton/glutamate-aspartate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 47 to 72 (26 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 235 to 264 (30 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 318 to 347 (30 residues), see Phobius details amino acids 357 to 382 (26 residues), see Phobius details amino acids 391 to 409 (19 residues), see Phobius details PF00375: SDF" amino acids 8 to 411 (404 residues), 398.8 bits, see alignment E=1.3e-123

Best Hits

Swiss-Prot: 100% identical to GLTP_ECOLI: Proton/glutamate-aspartate symporter (gltP) from Escherichia coli (strain K12)

KEGG orthology group: K11102, proton glutamate symport protein (inferred from 100% identity to eco:b4077)

MetaCyc: 100% identical to glutamate/aspartate : H+ symporter GltP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-122A; TRANS-RXN-162

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>OHPLBJKB_03963 Proton/glutamate-aspartate symporter (Escherichia coli HS(pFamp)R (ATCC 700891))
MKSIKFSLAWQILFAMVLGILLGSYLHYHSDSRDWLVVNLLSPAGDIFIHLIKMIVVPIV
ISTLVVGIAGVGDAKQLGRIGAKTIIYFEVITTVAIILGITLANVFQPGAGVDMSQLATV
DISKYQSTTEAVQSSSHGIMGTILSLVPTNIVASMAKGEMLPIIFFSVLFGLGLSSLPAT
HREPLVTVFRSISETMFKVTHMVMRYAPVGVFALIAVTVANFGFSSLWPLAKLVLLVHFA
ILFFALVVLGIVARLCGLSVWILIRILKDELILAYSTASSESVLPRIIEKMEAYGAPASI
TSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEIILVLTLMVTSKGIAGVPGV
SFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHKFDRKKA
LAYEREVLGKFDKTADQ