Protein Info for OHPLBJKB_03954 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Galactose-6-phosphate isomerase subunit LacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF02502: LacAB_rpiB" amino acids 61 to 97 (37 residues), 36.4 bits, see alignment E=2.4e-13

Best Hits

KEGG orthology group: K01808, ribose 5-phosphate isomerase B [EC: 5.3.1.6] (inferred from 100% identity to eoj:ECO26_5203)

Predicted SEED Role

"Ribose 5-phosphate isomerase B (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or LMPTP YwlE cluster or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.6

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>OHPLBJKB_03954 Galactose-6-phosphate isomerase subunit LacA (Escherichia coli HS(pFamp)R (ATCC 700891))
MQPVFLFKKRTGAMGGHVAGTAGFCVAVPAFYSWSMSEVIDKDTRSSERTDYPHYASEVA
LAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQRRN