Protein Info for OHPLBJKB_03941 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Phosphate-import permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 75 to 99 (25 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 16 to 258 (243 residues), 310.7 bits, see alignment E=3.8e-97 PF00528: BPD_transp_1" amino acids 88 to 258 (171 residues), 91.8 bits, see alignment E=2.3e-30

Best Hits

Swiss-Prot: 100% identical to PHNE_ECOBD: Phosphonate transport system permease protein PhnE (phnE) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 99% identity to sbc:SbBS512_E4605)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>OHPLBJKB_03941 Phosphate-import permease protein PhnE (Escherichia coli HS(pFamp)R (ATCC 700891))
MQTITIAPSKRSWFSLLSWAVVLAVLVVSWQGAEMAPLTLIKDGGNMATFAADFFPPDFS
QWQDYLTEMAVTLQIAVWGTALAVVLSIPFGLMSAENLVPWWVYQPVRRLMDACRAINEM
VFAMLFVVAVGLGPFAGVLALFIHTTGVLSKLLSEAVEAIEPGPVEGIRATGANKLEEIL
YGVLPQVMPLLISYSLYRFESNVRSATVVGMVGAGGIGVTLWEAIRGFQFQQTCALMVLI
IVTVSLLDFLSQRLRKHFI