Protein Info for OHPLBJKB_03870 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: RNA-binding protein Hfq

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02383: RNA chaperone Hfq
  • amino acids 5 to 64 (60 residues), 99.2 bits, E=4.4e-33
• PF17209: Hfq
  • amino acids 7 to 69 (63 residues), 102.5 bits, E=3.8e-34

Best Hits

Swiss-Prot: 100% identical to HFQ_SHIBS: RNA-binding protein Hfq (hfq) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K03666, host factor-I protein (inferred from 100% identity to eco:b4172)

Predicted SEED Role

"RNA-binding protein Hfq" in subsystem Hfl operon or Polyadenylation bacterial

Protein Sequence (102 amino acids)

>OHPLBJKB_03870 RNA-binding protein Hfq (Escherichia coli HS(pFamp)R (ATCC 700891))
MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS
TVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE