Protein Info for OHPLBJKB_03801 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF04751: DUF615" amino acids 26 to 176 (151 residues), 191.3 bits, see alignment E=4.9e-61

Best Hits

Swiss-Prot: 100% identical to YJGA_ECOSM: UPF0307 protein YjgA (yjgA) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K09889, ribosome-associated protein (inferred from 100% identity to eco:b4234)

Predicted SEED Role

"FIG138315: Putative alpha helix protein" in subsystem Putative TldE-TldD proteolytic complex

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>OHPLBJKB_03801 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLD
ADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEN
LRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAE
NEG