Protein Info for OHPLBJKB_03620 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Carnitinyl-CoA dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00378: ECH_1" amino acids 9 to 260 (252 residues), 291.7 bits, see alignment E=4.4e-91 PF16113: ECH_2" amino acids 15 to 217 (203 residues), 116.2 bits, see alignment E=2.4e-37

Best Hits

Swiss-Prot: 100% identical to CAID_ECOLI: Carnitinyl-CoA dehydratase (caiD) from Escherichia coli (strain K12)

KEGG orthology group: K08299, carnitinyl-CoA dehydratase [EC: 4.2.1.-] (inferred from 100% identity to eco:b0036)

MetaCyc: 100% identical to crotonobetainyl-CoA hydratase (Escherichia coli K-12 substr. MG1655)
CARNDETRU-RXN [EC: 4.2.1.149]

Predicted SEED Role

"Carnitine racemase (EC 5.-.-.-) / Carnitinyl-CoA dehydratase (EC 4.2.1.-)" (EC 4.2.1.-, EC 5.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 5.-.-.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.149 or 5.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>OHPLBJKB_03620 Carnitinyl-CoA dehydratase (Escherichia coli HS(pFamp)R (ATCC 700891))
MSESLHLTRNGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFF
SAGWDLKAAAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGYAFGGGFELALAADFIV
CADNASFALPEAKLGIVPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVV
SQAELMDNARELAQQLVNSAPLAIAALKEIFRTTSEMPVEEAYRYIRSGVLKHYPSVLHS
EDAIEGPLAFAEKRDPVWKGR