Protein Info for OHPLBJKB_03533 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Inner membrane transport permease YadH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 83 (27 residues), see Phobius details amino acids 104 to 131 (28 residues), see Phobius details amino acids 137 to 162 (26 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details PF01061: ABC2_membrane" amino acids 8 to 217 (210 residues), 137.5 bits, see alignment E=4.7e-44 PF12698: ABC2_membrane_3" amino acids 56 to 242 (187 residues), 32.2 bits, see alignment E=6.3e-12

Best Hits

Swiss-Prot: 100% identical to YADH_ECOLI: Inner membrane transport permease YadH (yadH) from Escherichia coli (strain K12)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to eco:b0128)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>OHPLBJKB_03533 Inner membrane transport permease YadH (Escherichia coli HS(pFamp)R (ATCC 700891))
MHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNLIGSRIGDMHGFSYMQF
IVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHVIIAGYVGGGVARGLFVG
ILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVFAKTFDDISLVPTFVLTPL
TYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGINDVPLVTTFGVLVVFIVAFY
LICWSLIQRGRGLRS