Protein Info for OHPLBJKB_03520 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR01498: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase" amino acids 4 to 134 (131 residues), 159.1 bits, see alignment E=2.9e-51 PF01288: HPPK" amino acids 5 to 134 (130 residues), 133 bits, see alignment E=3.4e-43

Best Hits

Swiss-Prot: 96% identical to HPPK_ECOLI: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK) from Escherichia coli (strain K12)

KEGG orthology group: K00950, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC: 2.7.6.3] (inferred from 96% identity to eco:b0142)

MetaCyc: 96% identical to 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (Escherichia coli K-12 substr. MG1655)
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase. [EC: 2.7.6.3]

Predicted SEED Role

"2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)" in subsystem Folate Biosynthesis (EC 2.7.6.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>OHPLBJKB_03520 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase (Escherichia coli HS(pFamp)R (ATCC 700891))
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILAVSSIYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELAFPDGETLREVLHTRAFDKLSKW