Protein Info for OHPLBJKB_03518 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Glutamyl-Q tRNA(Asp) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 16 to 281 (266 residues), 380.4 bits, see alignment E=2.4e-118 PF00749: tRNA-synt_1c" amino acids 19 to 284 (266 residues), 162 bits, see alignment E=8.4e-52

Best Hits

Swiss-Prot: 100% identical to GLUQ_ECOBW: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 100% identity to eco:b0144)

MetaCyc: 100% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 2.4.1.M62 or 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>OHPLBJKB_03518 Glutamyl-Q tRNA(Asp) synthetase (Escherichia coli HS(pFamp)R (ATCC 700891))
MLPPYFLFKEMTDTQYIGRFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPP
REVPGAAETILRQLEHYGLHWDGDVLWQSQRHDAYREALAWLHEQGLSYYCTCTRARIQS
IGGIYDGHCRVLHHGPDNAAVRIRQQHPVTQFTDQLRGIIHADEKLAREDFIIHRRDGLF
AYNLAVVVDDHFQGVTEIVRGADLIEPTVRQISLYQLFGWKVPDYIHLPLALNPQGAKLS
KQNHAPALPKGDPRPVLIAALQFLGQQAEAHWQDFSVEQILQSAVKNWRLTAVPESAIVN
STFSNASC