Protein Info for OHPLBJKB_03408 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Chemotaxis protein LafU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00691: OmpA" amino acids 70 to 163 (94 residues), 54.6 bits, see alignment E=5.8e-19

Best Hits

Swiss-Prot: 99% identical to LAFU_ECOLI: Putative truncated flagellar export/assembly protein LafU (lafU) from Escherichia coli (strain K12)

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 97% identity to ecv:APECO1_1739)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>OHPLBJKB_03408 Chemotaxis protein LafU (Escherichia coli HS(pFamp)R (ATCC 700891))
MAVPEETEKKARDVNEKTALLKKKSATELGELATSITTIARDAHMEANLEMEIVPQGLRV
LIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKNNIYNNWN
LSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDSKNPQSAGNRRIEIMVLTKSASDT
LYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR