Protein Info for OHPLBJKB_03346 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Autoinducer 2 import system permease protein LsrD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 90 to 116 (27 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 40 to 305 (266 residues), 110.8 bits, see alignment E=3.4e-36

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 99% identity to ecz:ECS88_0337)

Predicted SEED Role

"Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease component 1" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>OHPLBJKB_03346 Autoinducer 2 import system permease protein LsrD (Escherichia coli HS(pFamp)R (ATCC 700891))
MKKSWRNNVEFYLIGLLVLTVAAFSITMPEIFWSISNFQSVASQMPVLGILALAMAVTML
CGGINLSIIATANACSLVMAWVATQYPPGIATVVATLLAGAGAAVIIGLCNGVLIAGIRV
SPILATLGMMTLLKGINILVTGGSAIANYPSWVLWLNHAQWFGIPLPMWLFAAVALGLWI
LLEKTPLGKAIYLIGSNERATLYSGINTRRVLIWVYVISALLCAVAAFLMMSKLNSAKAS
YGESYLLVSILAAVLGGVNPDGGSGRIIGMVLALFLLQIIESGFNILGISPYLTMALWGT
LLLCFIQVRGMLGLDRVV