Protein Info for OHPLBJKB_03257 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Aldo-keto reductase IolS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00248: Aldo_ket_red
  • amino acids 15 to 312 (298 residues), 253.1 bits, E=1.5e-79

Best Hits

Swiss-Prot: 99% identical to YAJO_ECOLI: 1-deoxyxylulose-5-phosphate synthase YajO (yajO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b0419)

MetaCyc: 99% identical to 1-deoxyxylulose-5-phosphate synthase YajO (Escherichia coli K-12 substr. MG1655)
1.17.1.-

Predicted SEED Role

"FIG00553873: hypothetical protein"

Protein Sequence (324 amino acids)

>OHPLBJKB_03257 Aldo-keto reductase IolS (Escherichia coli HS(pFamp)R (ATCC 700891))
MQYNPLGKTDLRVSRLCLGCMTFGEPDRGNHAWTLPEESSRPIIKRALEGGINFFDTANS
YSDGSSEEIVGRALRDFARREDVVVATKVFHRVGDLPEGLSRAQILRSIDDSLRRLGMDY
VDILQIHRWDYNTPIEETLEALNDVVKAGKARYIGASSMHASQFAQALKLQKQHGWAQFI
SMQDHYNLIYREEEREMLPLCYQEGVAVIPWSPLARGRLTRPWGETTARLVSDEVGRNLY
KESDENDAQIAERLTGVSEELGATRAQVALAWLLSKPGIAAPIIGTSREEQLDELLNAVD
ITLKPEQIAELETPYKPHAVVGFK