Protein Info for OHPLBJKB_03241 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Cytochrome bo(3) ubiquinol oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01433: ubiquinol oxidase, subunit II
  • amino acids 13 to 239 (227 residues), 409.3 bits, E=1.9e-127
• PF00116: COX2
  • amino acids 149 to 218 (70 residues), 24.2 bits, E=2.7e-09
• PF06481: COX_ARM
  • amino acids 239 to 285 (47 residues), 66.4 bits, 1.6e-22

Best Hits

Swiss-Prot: 100% identical to CYOA_ECOLI: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Escherichia coli (strain K12)

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to eco:b0432)

MetaCyc: 100% identical to cytochrome bo3 subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Protein Sequence (315 amino acids)

>OHPLBJKB_03241 Cytochrome bo(3) ubiquinol oxidase subunit 2 (Escherichia coli HS(pFamp)R (ATCC 700891))
MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIVVIPAIL
MAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHALEPSKPL
AHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMNSFFIPRLG
SQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATPDRAEFDQWVAKAKQ
SPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKFMAHGKSMDMTQPEGEHSAH
EGMEGMDMSHAESAH