Protein Info for OHPLBJKB_03214 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Hemolysin expression-modulating protein Hha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 PF05321: HHA" amino acids 13 to 69 (57 residues), 135.1 bits, see alignment E=3.8e-44

Best Hits

Swiss-Prot: 100% identical to HHA_SHIFL: Hemolysin expression-modulating protein Hha (hha) from Shigella flexneri

KEGG orthology group: K05839, haemolysin expression modulating protein (inferred from 100% identity to eco:b0460)

Predicted SEED Role

"Haemolysin expression modulating protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (72 amino acids)

>OHPLBJKB_03214 Hemolysin expression-modulating protein Hha (Escherichia coli HS(pFamp)R (ATCC 700891))
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLY
DKIPSSVWKFIR