Protein Info for OHPLBJKB_03157 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: UDP-2,3-diacylglucosamine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF12850: Metallophos_2" amino acids 1 to 120 (120 residues), 27.9 bits, see alignment E=2.2e-10 PF00149: Metallophos" amino acids 2 to 199 (198 residues), 44.5 bits, see alignment E=2.5e-15 TIGR01854: UDP-2,3-diacylglucosamine diphosphatase" amino acids 3 to 232 (230 residues), 388.7 bits, see alignment E=3.7e-121

Best Hits

Swiss-Prot: 100% identical to LPXH_ECOLC: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 100% identity to eco:b0524)

MetaCyc: 100% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>OHPLBJKB_03157 UDP-2,3-diacylglucosamine hydrolase (Escherichia coli HS(pFamp)R (ATCC 700891))
MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEAWIGDDDPNPLHRKMA
AAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLELYGRRVLIMHGDTLCT
DDAGYQAFRAKVHKPWLQTLFLALPLFVRKRIAARMRANSKEANSSKSLAIMDVNQNAVV
SAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTEGSMVKVTADDVELIHFPF