Protein Info for OHPLBJKB_03135 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Cation efflux system protein CusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF19335: HMBD" amino acids 44 to 71 (28 residues), 46.3 bits, see alignment (E = 8.1e-16) PF00529: CusB_dom_1" amino acids 94 to 378 (285 residues), 42.8 bits, see alignment E=9.9e-15 PF16576: HlyD_D23" amino acids 109 to 313 (205 residues), 197.4 bits, see alignment E=4.7e-62 PF16572: HlyD_D4" amino acids 150 to 204 (55 residues), 101.2 bits, see alignment 5.6e-33 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 203 to 391 (189 residues), 101.2 bits, see alignment E=2.8e-33 PF13437: HlyD_3" amino acids 209 to 310 (102 residues), 46 bits, see alignment E=1.9e-15

Best Hits

Swiss-Prot: 100% identical to CUSB_ECOLI: Cation efflux system protein CusB (cusB) from Escherichia coli (strain K12)

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 100% identity to eco:b0574)

MetaCyc: 100% identical to copper/silver export system membrane fusion protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-90; TRANS-RXN0-280

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>OHPLBJKB_03135 Cation efflux system protein CusB (Escherichia coli HS(pFamp)R (ATCC 700891))
MKKIALIIGSMIAGGIISAAGFTWVAKAEPPAEKTSTAERKILFWYDPMYPNTRFDKPGK
SPFMDMDLVPKYADEESSASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQ
YAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEG
ILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQG
MDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEV
DNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQA
SQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRSESATHAH