Protein Info for OHPLBJKB_03084 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Putative cryptic C4-dicarboxylate transporter DcuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 28 to 47 (20 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 117 to 149 (33 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 309 to 333 (25 residues), see Phobius details amino acids 336 to 337 (2 residues), see Phobius details amino acids 339 to 363 (25 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details amino acids 435 to 458 (24 residues), see Phobius details PF03606: DcuC" amino acids 6 to 451 (446 residues), 504 bits, see alignment E=3.4e-155 TIGR00771: transporter, anaerobic C4-dicarboxylate uptake C (DcuC) family" amino acids 58 to 441 (384 residues), 655.6 bits, see alignment E=1.6e-201 PF06808: DctM" amino acids 147 to 448 (302 residues), 34.3 bits, see alignment E=1.3e-12

Best Hits

Swiss-Prot: 100% identical to DCUC_ECO57: Anaerobic C4-dicarboxylate transporter DcuC (dcuC) from Escherichia coli O157:H7

KEGG orthology group: K03326, C4-dicarboxylate transporter, DcuC family (inferred from 100% identity to eco:b0621)

MetaCyc: 100% identical to anaerobic C4-dicarboxylate transporter DcuC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-299; TRANS-RXN-300

Predicted SEED Role

"C4-dicarboxylate transporter DcuC (TC 2.A.61.1.1)" (TC 2.A.61.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>OHPLBJKB_03084 Putative cryptic C4-dicarboxylate transporter DcuD (Escherichia coli HS(pFamp)R (ATCC 700891))
MLTFIELLIGVVVIVGVARYIIKGYSATGVLFVGGLLLLIISAIMGHKVLPSSQASTGYS
ATDIVEYVKILLMSRGGDLGMMIMMLCGFAAYMTHIGANDMVVKLASKPLQYINSPYLLM
IAAYFVACLMSLAVSSATGLGVLLMATLFPVMVNVGISRGAAAAICASPAAIILAPTSGD
VVLAAQASEMSLIDFAFKTTLPISIAAIIGMAIAHFFWQRYLDKKEHISHEMLDVSEITT
TAPAFYAILPFTPIIGVLIFDGKWGPQLHIITILVICMLIASILEFLRSFNTQKVFSGLE
VAYRGMADAFANVVMLLVAAGVFAQGLSTIGFIQSLISIATSFGSASIILMLVLVILTML
AAVTTGSGNAPFYAFVEMIPKLAHSSGINPAYLTIPMLQASNLGRTLSPVSGVVVAVAGM
AKISPFEVVKRTSVPVLVGLVIVIVATELMVPGTAAAVTGK