Protein Info for OHPLBJKB_03073 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Endolytic peptidoglycan transglycosylase RlpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03330: DPBB_1" amino acids 79 to 166 (88 residues), 73.9 bits, see alignment E=9.9e-25 TIGR00413: rare lipoprotein A" amino acids 81 to 180 (100 residues), 99.3 bits, see alignment E=1.5e-32 PF05036: SPOR" amino acids 287 to 359 (73 residues), 62 bits, see alignment E=5.4e-21

Best Hits

Swiss-Prot: 100% identical to RLPA_ECOLI: Endolytic peptidoglycan transglycosylase RlpA (rlpA) from Escherichia coli (strain K12)

KEGG orthology group: K03642, rare lipoprotein A (inferred from 100% identity to eco:b0633)

Predicted SEED Role

"Rare lipoprotein A precursor" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>OHPLBJKB_03073 Endolytic peptidoglycan transglycosylase RlpA (Escherichia coli HS(pFamp)R (ATCC 700891))
MRKQWLGICIAAGMLAACTSDDGQQQTVSVPQPAVCNGPIVEISGADPRFEPLNATANQD
YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR
ITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNNTKVRIDPIIVAQDGSLSGP
GMACTTVAKQTYALPAPPDLSGGAGTSSVSGPQGDILPVSNSTLKSEDPTGAPVTSSGFL
GAPTTLAPGVLEGSEPTPAPQPVVTAPSTTPATSPAMVTPQAASQSASGNFMVQVGAVSD
QARAQQYQQQLGQKFGVPGRVTQNGAVWRIQLGPFASKAEASTLQQRLQTEAQLQSFITT
AQ