Protein Info for OHPLBJKB_02995 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Succinate dehydrogenase cytochrome b556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details PF01127: Sdh_cyt" amino acids 11 to 128 (118 residues), 110.5 bits, see alignment E=3e-36 TIGR02970: succinate dehydrogenase, cytochrome b556 subunit" amino acids 12 to 131 (120 residues), 134.7 bits, see alignment E=9.1e-44

Best Hits

Swiss-Prot: 100% identical to DHSC_ECOLI: Succinate dehydrogenase cytochrome b556 subunit (sdhC) from Escherichia coli (strain K12)

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 98% identity to cko:CKO_02438)

MetaCyc: 100% identical to succinate:quinone oxidoreductase, membrane protein SdhC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>OHPLBJKB_02995 Succinate dehydrogenase cytochrome b556 subunit (Escherichia coli HS(pFamp)R (ATCC 700891))
MWALFMIRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSP
EGFEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFV
ITVVLSLLAGVLVW