Protein Info for OHPLBJKB_02955 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Galactose-1-phosphate uridylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00209: galactose-1-phosphate uridylyltransferase" amino acids 1 to 347 (347 residues), 712.9 bits, see alignment E=3e-219 PF01087: GalP_UDP_transf" amino acids 3 to 176 (174 residues), 232.9 bits, see alignment E=6e-73 PF02744: GalP_UDP_tr_C" amino acids 183 to 345 (163 residues), 262.7 bits, see alignment E=1.8e-82

Best Hits

Swiss-Prot: 100% identical to GAL7_ECOLI: Galactose-1-phosphate uridylyltransferase (galT) from Escherichia coli (strain K12)

KEGG orthology group: K00965, UDPglucose--hexose-1-phosphate uridylyltransferase [EC: 2.7.7.12] (inferred from 100% identity to eco:b0758)

MetaCyc: 100% identical to galactose-1-phosphate uridylyltransferase (Escherichia coli K-12 substr. MG1655)
UDP-glucose--hexose-1-phosphate uridylyltransferase. [EC: 2.7.7.12]

Predicted SEED Role

"Galactose-1-phosphate uridylyltransferase (EC 2.7.7.10)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.7.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.10 or 2.7.7.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>OHPLBJKB_02955 Galactose-1-phosphate uridylyltransferase (Escherichia coli HS(pFamp)R (ATCC 700891))
MTQFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQVLPAHDPDCFLCAGNVR
VTGDKNPDYTGTYVFTNDFAALMSDTPDAPESHDPLMRCQSARGTSRVICFSPDHSKTLP
ELSVAALTEIVKTWQEQTAELGKTYPWVQVFENKGAAMGCSNPHPHGQIWANSFLPNEAE
REDRLQKEYFAEQKSPMLVDYVQRELADGSRTVVETEHWLAVVPYWAAWPFETLLLPKAH
VLRITDLTDAQRSDLALALKKLTSRYDNLFQCSFPYSMGWHGAPFNGEENQHWQLHAHFY
PPLLRSATVRKFMVGYEMLAETQRDLTAEQAAERLRAVSDIHFRESGV