Protein Info for OHPLBJKB_02926 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details PF01027: Bax1-I" amino acids 19 to 222 (204 residues), 70.9 bits, see alignment E=6.8e-24

Best Hits

Swiss-Prot: 98% identical to YBHM_ECOLI: Uncharacterized protein YbhM (ybhM) from Escherichia coli (strain K12)

KEGG orthology group: K06890, (no description) (inferred from 98% identity to eco:b0787)

Predicted SEED Role

"FIG00638277: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>OHPLBJKB_02926 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MESYSKNSNKLDFQHEARILNGIWLITALGLVATAGLAWGAKYLEITATKYDSPPMYVAI
GLLLLCMYGLSKDINKINAAIAGVIYLFLLSLVAIVVASLVPVYAIIIVFSTAGAMFLIS
MLAGLLFNVDPGSHRFIIMMTLTGLALVIIVNAALMSERPIWVISCLMIVLWPGIISHGR
NKLLELAGKCHSEELWSPVRCAFTGALTLYYYFIGFFGILAAIAITLVWQRHTRFFH