Protein Info for OHPLBJKB_02868 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Multidrug transporter MdfA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 172 to 188 (17 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 258 to 275 (18 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 364 (340 residues), 104.2 bits, see alignment E=7.3e-34 PF00083: Sugar_tr" amino acids 58 to 195 (138 residues), 24.4 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 100% identical to MDFA_ECOL6: Multidrug transporter MdfA (mdfA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K08160, MFS transporter, DHA1 family, multidrug/chloramphenicol efflux transport protein (inferred from 100% identity to eco:b0842)

MetaCyc: 100% identical to multidrug efflux pump MdfA / Na+:H+ antiporter / K+:H+ antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-101; TRANS-RXN-337; TRANS-RXN-338; TRANS-RXN-42; TRANS-RXN-44

Predicted SEED Role

"Multidrug translocase MdfA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>OHPLBJKB_02868 Multidrug transporter MdfA (Escherichia coli HS(pFamp)R (ATCC 700891))
MQNKLASGARLGRQALLFPLCLVLYEFSTYIGNDMIQPGMLAVVEQYQAGIDWVPTSMTA
YLAGGMFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLC
FIGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAAL
AAISFFGLQRAMPETATRIGEKLSLKELGRDYKLVLKNGRFVAGALALGFVSLPLLAWIA
QSPIIIITGEQLSSYEYGLLQVPIFGALIAGNLLLARLTSRRTVRSLIIMGGWPIMIGLL
VAAAATVISSHAYLWMTAGLSIYAFGIGLANAGLVRLTLFASDMSKGTVSAAMGMLQMLI
FTVGIEISKHAWLNGGNGQFNLFNLVNGILWLSLMVIFLKDKQMGNSHEG