Protein Info for OHPLBJKB_02821 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Aspartate/alanine antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details amino acids 447 to 465 (19 residues), see Phobius details amino acids 476 to 498 (23 residues), see Phobius details amino acids 534 to 559 (26 residues), see Phobius details PF06826: Asp-Al_Ex" amino acids 17 to 182 (166 residues), 136.8 bits, see alignment E=6.8e-44 amino acids 385 to 555 (171 residues), 149.6 bits, see alignment E=7.8e-48 TIGR01625: AspT/YidE/YbjL antiporter duplication domain" amino acids 21 to 169 (149 residues), 128.3 bits, see alignment E=1.1e-41 amino acids 390 to 541 (152 residues), 147.9 bits, see alignment E=1e-47 PF02080: TrkA_C" amino acids 229 to 282 (54 residues), 38.4 bits, see alignment 9e-14 amino acids 304 to 371 (68 residues), 36.8 bits, see alignment E=2.9e-13

Best Hits

Swiss-Prot: 100% identical to YBJL_ECOL6: Putative transport protein YbjL (ybjL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07085, putative transport protein (inferred from 100% identity to eco:b0847)

Predicted SEED Role

"TrkA, Potassium channel-family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>OHPLBJKB_02821 Aspartate/alanine antiporter (Escherichia coli HS(pFamp)R (ATCC 700891))
MNINVAELLNGNYILLLFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTD
ALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGL
TAGMLAGSMTSTPVLVGAGDTLRHSGMESRQLSLALDNLSLGYALTYLIGLVSLIVGARY
LPKLQHQDLQTSAQQIARERGLDTDANRKVYLPVIRAYRVGPELVAWTDGKNLRELGIYR
QTGCYIERIRRNGILANPDGDAVLQMGDEIALVGYPDAHARLDPSFRNGKEVFDRDLLDM
RIVTEEVVVKNHNAVGKRLAQLKLTDHGCFLNRVIRSQIEMPIDDNVVLNKGDVLQVSGD
ARRVKTIADRIGFISIHSQVTDLLAFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLLFAG
IMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLIAGL
IVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAGTYA
IANVLLTLAGTIIVMVWPGLG