Protein Info for OHPLBJKB_02766 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Pyruvate formate-lyase 1-activating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR02493: pyruvate formate-lyase 1-activating enzyme" amino acids 6 to 239 (234 residues), 357.9 bits, see alignment E=2.1e-111 PF13353: Fer4_12" amino acids 16 to 148 (133 residues), 63.3 bits, see alignment E=3.2e-21 PF04055: Radical_SAM" amino acids 24 to 178 (155 residues), 97.8 bits, see alignment E=8.4e-32

Best Hits

Swiss-Prot: 100% identical to PFLA_SHIFL: Pyruvate formate-lyase 1-activating enzyme (pflA) from Shigella flexneri

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to eco:b0902)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>OHPLBJKB_02766 Pyruvate formate-lyase 1-activating enzyme (Escherichia coli HS(pFamp)R (ATCC 700891))
MSVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEV
VTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDEL
LEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDDS
AHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQY
GHKVMF