Protein Info for OHPLBJKB_02708 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Cell division inhibitor SulA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 TIGR00623: cell division inhibitor SulA" amino acids 2 to 169 (168 residues), 335.4 bits, see alignment E=2.9e-105 PF03846: SulA" amino acids 31 to 119 (89 residues), 170.5 bits, see alignment E=3.6e-55

Best Hits

Swiss-Prot: 100% identical to SULA_ECOSM: Cell division inhibitor SulA (sulA) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K13053, cell division inhibitor SulA (inferred from 100% identity to eco:b0958)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>OHPLBJKB_02708 Cell division inhibitor SulA (Escherichia coli HS(pFamp)R (ATCC 700891))
MYTSGYAHRSSSFSSAASKIARVSTENTTAGLISEVVYREDQPMMTQLLLLPLLQQLGQQ
SRWQLWLTPQQKLSREWVQASGLPLTKVMQISQLSPCHTVESMVRALRTGNYSVVIGWLA
DDLTEEEHAELVDAANEGNAMGFIMRPVSASSHATRQLSGLKIHSNLYH