Protein Info for OHPLBJKB_02706 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Inner membrane protein YccS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 59 (17 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details amino acids 443 to 462 (20 residues), see Phobius details amino acids 468 to 485 (18 residues), see Phobius details amino acids 490 to 508 (19 residues), see Phobius details amino acids 512 to 513 (2 residues), see Phobius details amino acids 515 to 535 (21 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 11 to 708 (698 residues), 1164.8 bits, see alignment E=0 TIGR01666: TIGR01666 family membrane protein" amino acids 11 to 709 (699 residues), 1262.2 bits, see alignment E=0 PF12805: FUSC-like" amino acids 69 to 348 (280 residues), 367.9 bits, see alignment E=4.6e-114 PF04632: FUSC" amino acids 157 to 578 (422 residues), 33.5 bits, see alignment E=3e-12 amino acids 395 to 688 (294 residues), 37.1 bits, see alignment E=2.5e-13 PF13515: FUSC_2" amino acids 408 to 528 (121 residues), 100.4 bits, see alignment E=1.3e-32

Best Hits

Swiss-Prot: 100% identical to YCCS_ECOLI: Inner membrane protein YccS (yccS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecs:ECs1044)

Predicted SEED Role

"Putative efflux (PET) family inner membrane protein YccS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (720 amino acids)

>OHPLBJKB_02706 Inner membrane protein YccS (Escherichia coli HS(pFamp)R (ATCC 700891))
MAFMLSPLLKRYTWNSAWLYYARIFIALCGTTAFPWWLGDVKLTIPLTLGMVAAALTDLD
DRLAGRLRNLIITLFCFFIASASVELLFPWPWLFAIGLTLSTSGFILLGGLGQRYATIAF
GALLIAIYTMLGTSLYEHWYQQPMYLLAGAVWYNVLTLIGHLLFPVRPLQDNLARCYEQL
ARYLELKSRMFDPDIEDQSQAPLYDLALANGLLMATLNQTKLSLLTRLRGDRGQRGTRRT
LHYYFVAQDIHERASSSHIQYQTLREHFRHSDVLFRFQRLMSMQGQACQQLSRCILLRQP
YQHDPHFERAFTHIDAALERMRDNGAPADLLKTLGFLLNNLRAIDAQLATIESEQAQALP
HNNDENELADDSPHGLSDIWLRLSRHFTPESALFRHAVRMSLVLCFGYAIIQITGMHHGY
WILLTSLFVCQPNYNATRHRLKLRIIGTLVGIAIGIPVLWFVPSLEGQLVLLVITGVLFF
AFRNVQYAHATMFITLLVLLCFNLLGEGFEVALPRVIDTLIGCAIAWAAVSYIWPDWQFR
NLPRMLERATEANCRYLDAILEQYHQGRDNRLAYRIARRDAHNRDAELASVVSNMSSEPN
VTPQIREAAFRLLCLNHTFTSYISALGAHREQLTNPEILAFLDDAVCYVDDALHHQPADE
ERVNEALASLKQRMQQLEPRADSKEPLVVQQVGLLIALLPEIGRLQRQITQVPQETPVSA