Protein Info for OHPLBJKB_02691 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Hydrogenase 1 maturation protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 TIGR00140: hydrogenase expression/formation protein" amino acids 6 to 157 (152 residues), 203.3 bits, see alignment E=1.9e-64 TIGR00072: hydrogenase maturation protease" amino acids 7 to 153 (147 residues), 146 bits, see alignment E=7.8e-47 PF01750: HycI" amino acids 23 to 151 (129 residues), 141.5 bits, see alignment E=7.1e-46

Best Hits

Swiss-Prot: 100% identical to HYAD_ECOLI: Hydrogenase 1 maturation protease (hyaD) from Escherichia coli (strain K12)

KEGG orthology group: K03605, hydrogenase 1 maturation protease [EC: 3.4.24.-] (inferred from 100% identity to eco:b0975)

Predicted SEED Role

"Hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Membrane-bound Ni, Fe-hydrogenase (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>OHPLBJKB_02691 Hydrogenase 1 maturation protease (Escherichia coli HS(pFamp)R (ATCC 700891))
MSEQRVVVMGLGNLLWADEGFGVRVAERLYAHYHWPEYVEIVDGGTQGLNLLGYVESASH
LLILDAIDYGLEPGTLRTYAGERIPAYLSAKKMSLHQNSFSEVLALADIRGHLPAHIALV
GLQPAMLDDYGGSLSELAREQLPAAEQAALAQLAAWGIVPQPANESRCLNYDCLSMENYE
GVRLRQYRMTQEEQG