Protein Info for OHPLBJKB_02644 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03938: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB" amino acids 49 to 665 (617 residues), 896 bits, see alignment E=5.2e-274 PF01522: Polysacc_deac_1" amino acids 102 to 270 (169 residues), 82 bits, see alignment E=3.5e-27 PF14883: GHL13" amino acids 318 to 645 (328 residues), 483.9 bits, see alignment E=2.1e-149

Best Hits

Swiss-Prot: 100% identical to PGAB_ECOLI: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase (pgaB) from Escherichia coli (strain K12)

KEGG orthology group: K11931, biofilm PGA synthesis lipoprotein PgaB [EC: 3.-.-.-] (inferred from 100% identity to eco:b1023)

MetaCyc: 100% identical to poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase and beta-1,6 glycoside hydrolase (Escherichia coli K-12 substr. MG1655)
3.5.1.-; 3.2.1.-

Predicted SEED Role

"Biofilm PGA synthesis deacetylase PgaB (EC 3.-)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (672 amino acids)

>OHPLBJKB_02644 Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase (Escherichia coli HS(pFamp)R (ATCC 700891))
MLRNGNKYLLMLVSIIMLTACISQSRTSFIPPQDRESLLAEQPWPHNGFVAISWHNVEDE
AADQRFMSVRTSALREQFAWLRENGYQPVSIAQIREARRGGKPLPEKAVVLTFDDGYQSF
YTRVFPILQAFQWPAVWAPVGSWVDTPADKQVKFGDELVDREYFATWQQVREVARSRLVE
LASHTWNSHYGIQANATGSLLPVYVNRAYFTDHARYETAAEYRERIRLDAVKMTEYLRTK
VEVNPHVFVWPYGEANGIAIEELKKLGYDMFFTLESGLANASQLDSIPRVLIANNPSLKE
FAQQIITVQEKSPQRIMHIDLDYVYDENLQQMDRNIDVLIQRVKDMQISTVYLQAFADPD
GDGLVKEVWFPNRLLPMKADIFSRVAWQLRTRSGVNIYAWMPVLSWDLDPTLTRVKYLPT
GEKKAQIHPEQYHRLSPFDDRVRAQVGMLYEDLAGHAAFDGILFHDDALLSDYEDASAPA
ITAYQQAGFSGSLSEIRQNPEQFKQWARFKSRALTDFTLELSARVKAIRGPHIKTARNIF
ALPVIQPESEAWFAQNYADFLKSYDWTAIMAMPYLEGVAEKSADQWLIQLTNQIKNIPQA
KDKSILELQAQNWQKNGQHQAISSQQLAHWMSLLQLNGVKNYGYYPDNFLHNQPEIDLIR
PEFSTAWYPKND