Protein Info for OHPLBJKB_02608 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Cytochrome b561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 180 (172 residues), 105.1 bits, see alignment E=1.9e-34

Best Hits

Swiss-Prot: 100% identical to C56I_ECOLI: Cytochrome b561 homolog 2 (yceJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1057)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>OHPLBJKB_02608 Cytochrome b561 (Escherichia coli HS(pFamp)R (ATCC 700891))
MSFTNTPERYGVISAAFHWLSAIIVYGMFALGLWMVTLSYYDGWYHKAPELHKSIGILLM
MGLVIRVLWRVISPPPGPLPSYSPMTRLAAKAGHLALYLLLFAIGISGYLISTADGKPIS
VFGWFDVPATLADAGAQADFAGALHFWLAWSVVVLSVMHGFMALKHHFIDKDDTLKRMLG
KSSSDYGV