Protein Info for OHPLBJKB_02523 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: putative cyclic di-GMP phosphodiesterase PdeG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details PF12792: CSS-motif" amino acids 31 to 217 (187 residues), 99.3 bits, see alignment E=2.2e-32 PF00563: EAL" amino acids 251 to 486 (236 residues), 223.8 bits, see alignment E=2.1e-70

Best Hits

Swiss-Prot: 100% identical to PDEG_ECOLI: Probable cyclic di-GMP phosphodiesterase PdeG (pdeG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1168)

Predicted SEED Role

"FIG00638205: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>OHPLBJKB_02523 putative cyclic di-GMP phosphodiesterase PdeG (Escherichia coli HS(pFamp)R (ATCC 700891))
MRNTLIPILVAICLFITGVAILNIQLWYSAKAEYLAGARYAANNINHILEEASQATQTAV
NIAGKECNLEEQYQLGTEAALKPHLRTIIILKQGIVWCTSLPGNRVLLSRIPVFPDSNLL
LAPAIDTVNRLPILLYQNQFADTRILVTISDQHIRGALNVPLKGVRYVLRVADDIIGPTG
DVMTLNGHYPYTEKVHSTKYHFTIIFNPPPLFSFYRLIDKGFGILIFILLIACAAAFLLD
RYFNKSATPEEILRRAINNGEIVPFYQPVVNGREGTLRGVEVLARWKQPHGGYISPAAFI
PLAEKSGLIVPLTQSLMNQVARQMNAIASKLPEGFHIGINFSASHIISPTFVDECLNFRD
SFTRRDLNLVLEVTEREPLNVDESLVQRLNILHENGFVIALDDFGTGYSGLSYLHDLHID
YIKIDHSFVGRVNADPESTRILDCVLDLARKLSISIVAEGVETKEQLDYLNQNNITFQQG
YYFYKPVTYIDLVKIILSKPKVKVVVE