Protein Info for OHPLBJKB_02392 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Putrescine export system ATP-binding protein SapF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 30 to 179 (150 residues), 126.9 bits, E=4.4e-41

Best Hits

Swiss-Prot: 100% identical to SAPF_ECOLI: Putrescine export system ATP-binding protein SapF (sapF) from Escherichia coli (strain K12)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to eco:b1290)

MetaCyc: 100% identical to putrescine ABC exporter ATP binding protein SapF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Peptide transport system ATP-binding protein SapF"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Protein Sequence (268 amino acids)

>OHPLBJKB_02392 Putrescine export system ATP-binding protein SapF (Escherichia coli HS(pFamp)R (ATCC 700891))
MIETLLEVRNLSKTFRYRTGWFRRQTVEAVKPLSFTLREGQTLAIIGENGSGKSTLAKML
AGMIEPTSGELLIDDHPLHFGDYSFRSQRIRMIFQDPSTSLNPRQRISQILDFPLRLNTD
LEPEQRRKQIIETMRMVGLLPDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEALAS
LDMSMRSQLINLMLELQEKQGISYIYVTQHIGMMKHISDQVLVMHQGEVVERGSTADVLA
SPLHELTKRLIAGHFGEALTADAWRKDR