Protein Info for OHPLBJKB_02384 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF07722: Peptidase_C26" amino acids 8 to 224 (217 residues), 233.5 bits, see alignment E=2.6e-73 PF00117: GATase" amino acids 95 to 241 (147 residues), 46.4 bits, see alignment E=3.9e-16

Best Hits

Swiss-Prot: 100% identical to PUUD_ECOLI: Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD (puuD) from Escherichia coli (strain K12)

KEGG orthology group: K09473, gamma-glutamyl-gamma-aminobutyrate hydrolase [EC: 3.5.1.94] (inferred from 100% identity to eco:b1298)

MetaCyc: 100% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>OHPLBJKB_02384 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD (Escherichia coli HS(pFamp)R (ATCC 700891))
MENIMNNPVIGVVMCRNRLKGHATQTLQEKYLNAIIHAGGLPIALPHALAEPSLLEQLLP
KLDGIYLPGSPSNVQPHLYGENGDEPDADPGRDLLSMAIINAALERRIPIFAICRGLQEL
VVATGGSLHRKLCEQPELLEHREDPELPVEQQYAPSHEVQVEEGGLLSALLPECSNFWVN
SLHGQGAKVVSPRLRVEARSPDGLVEAVSVINHPFALGVQWHPEWNSSEYALSRILFEGF
ITACQHHIAEKQRL