Protein Info for OHPLBJKB_02317 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: 1,2-epoxyphenylacetyl-CoA isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02280: phenylacetate degradation probable enoyl-CoA hydratase PaaB
  • amino acids 5 to 262 (258 residues), 482.7 bits, E=1.3e-149
• PF00378: ECH_1
  • amino acids 10 to 261 (252 residues), 211.5 bits, E=1.4e-66
• PF16113: ECH_2
  • amino acids 14 to 200 (187 residues), 128.5 bits, E=4.3e-41

Best Hits

Swiss-Prot: 100% identical to PAAG_ECOLI: 1,2-epoxyphenylacetyl-CoA isomerase (paaG) from Escherichia coli (strain K12)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to eco:b1394)

MetaCyc: 65% identical to 1,2-epoxyphenylacetyl-CoA isomerase (Pseudomonas sp. Y2)
RXN0-6510 [EC: 5.3.3.18]

Predicted SEED Role

"Phenylacetate degradation enoyl-CoA hydratase PaaB (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (32/35 steps found)
• superpathway of phenylethylamine degradation (11/11 steps found)
• phenylacetate degradation I (aerobic) (9/9 steps found)
• adipate degradation (5/5 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• valproate β-oxidation (5/9 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• 3-phenylpropanoate degradation (3/10 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• platensimycin biosynthesis (6/26 steps found)
• Spodoptera littoralis pheromone biosynthesis (3/22 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17 or 5.3.3.18

Protein Sequence (262 amino acids)

>OHPLBJKB_02317 1,2-epoxyphenylacetyl-CoA isomerase (Escherichia coli HS(pFamp)R (ATCC 700891))
MMEFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGF
CAGQDLNDRNVDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALG
GDIVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGM
IWQVVDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGR
SADYREGVSAFLAKRSPQFTGK