Protein Info for OHPLBJKB_02311 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Carnitine operon protein CaiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR02287: phenylacetic acid degradation protein PaaY" amino acids 3 to 195 (193 residues), 377.1 bits, see alignment E=8e-118 PF00132: Hexapep" amino acids 88 to 122 (35 residues), 34.4 bits, see alignment 5.9e-13

Best Hits

Swiss-Prot: 100% identical to PAAY_ECOLI: Phenylacetic acid degradation protein PaaY (paaY) from Escherichia coli (strain K12)

KEGG orthology group: K02617, phenylacetic acid degradation protein (inferred from 100% identity to eco:b1400)

MetaCyc: 100% identical to 2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>OHPLBJKB_02311 Carnitine operon protein CaiE (Escherichia coli HS(pFamp)R (ATCC 700891))
MPIYQIDGLTPVVPEESFVHPTAVLIGDVILGKGVYVGPNASLRGDFGRIVVKDGANIQD
NCVMHGFPEQDTVVGEDGHIGHSAILHGCIIRRNALVGMNAVVMDGAVIGENSIVGASAF
VKAKAEMPANYLIVGSPAKAIRELSEQELAWKKQGTHEYQVLVTRCKQTLHQVEPLREVE
PGRKRLVFDENLRPKQ