Protein Info for OHPLBJKB_02304 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: putative protein YnbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 PF12146: Hydrolase_4" amino acids 32 to 266 (235 residues), 222.8 bits, see alignment E=8.5e-70 PF00561: Abhydrolase_1" amino acids 38 to 140 (103 residues), 31.9 bits, see alignment E=2.2e-11 PF12697: Abhydrolase_6" amino acids 50 to 257 (208 residues), 38.5 bits, see alignment E=4.3e-13 PF12147: Methyltransf_20" amino acids 275 to 582 (308 residues), 508.7 bits, see alignment E=1.1e-156

Best Hits

Swiss-Prot: 100% identical to YNBC_ECOLI: Uncharacterized protein YnbC (ynbC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1410)

Predicted SEED Role

"Putative lipase in cluster with Phosphatidate cytidylyltransferase" in subsystem Triacylglycerol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (585 amino acids)

>OHPLBJKB_02304 putative protein YnbC (Escherichia coli HS(pFamp)R (ATCC 700891))
MENSRIPGEHFFTTSDNTALFYRHWPALQPGAKKVIVLFHRGHEHSGRLQHLVDELAMPD
TAFYAWDARGHGKSSGPRGYSPSLARSVRDVDEFVRFAASDSQVGLEEVVVIAQSVGAVL
VATWIHDYAPAIRGLVLASPAFKVKLYVPLARPALALWHRLRGLFFINSYVKGRYLTHDR
QRGASFNNDPLITRAIAVNILLDLYKTSERIIRDAAAITLPTQLLISGDDYVVHRQPQID
FYQRLRSPLKELHLLPGFYHDTLGEENRALAFEKMQSFISRLYANKSQKFDYQHEDCTGP
SADRWRLLSGGPVPLSPVDLVYRFMRKAMKLFGTHSSGLHLGMSTGFDSGSSLDYVYQNQ
PQGSNAFGRLIDKIYLNSVGWRGIRQRKTHLQILIKQAVADLHAKGLAVRVVDIAAGHGR
YVLDALANEPAVSDILLRDYSELNVAQGQEMIAQRGMSGRVRFEQGDAFNPEELSALTPR
PTLAIVSGLYELFPENEQVKNSLAGLANAIEPGGILIYTGQPWHPQLEMIAGVLTSHKDG
KPWVMRVRSQGEMDSLVRDAGFDKCTQRIDEWGIFTVSMAVRRDN