Protein Info for OHPLBJKB_02293 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: HTH-type transcriptional regulator CatM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00126: HTH_1" amino acids 45 to 104 (60 residues), 68.4 bits, see alignment E=4.2e-23 PF03466: LysR_substrate" amino acids 132 to 336 (205 residues), 121.1 bits, see alignment E=4.4e-39

Best Hits

Swiss-Prot: 100% identical to YDCI_ECOLI: Uncharacterized HTH-type transcriptional regulator YdcI (ydcI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ecc:c1847)

Predicted SEED Role

"LysR family transcriptional regulator YdcI" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>OHPLBJKB_02293 HTH-type transcriptional regulator CatM (Escherichia coli HS(pFamp)R (ATCC 700891))
MIALIVNNILQSSYHNQTTSLVSDTASFLTSLMEKNSLFSQRIRLRHLHTFVAVAQQGTL
GRAAETLNLSQPALSKTLNELEQLTGARLFERGRQGAQLTLPGEQFLTHAVRVLDAINTA
GQSLHRKEGLNNDVVRVGALPTAALGILPSVIGQFHQQQKETTLQVATMSNPMILAGLKT
GEIDIGIGRMSDPELMTGLNYELLFLESLKLVVRPNHPLLQENVTLSRVLEWPVVVSPEG
TAPRQHSDALVQSQGCKIPSGCIETLSASLSRQLTVEYDYVWFVPSGAVKDDLRHATLVA
LPVPGHGAGEPIGILTRVDATFSSGCQLMINAIRKSMPF