Protein Info for OHPLBJKB_02233 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: putative D,D-dipeptide transport ATP-binding protein DdpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF00005: ABC_tran" amino acids 25 to 185 (161 residues), 106 bits, see alignment E=2.6e-34 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 235 to 320 (86 residues), 75.4 bits, see alignment E=1.5e-25 PF08352: oligo_HPY" amino acids 236 to 300 (65 residues), 71.3 bits, see alignment E=7.2e-24

Best Hits

Swiss-Prot: 100% identical to DDPD_ECOLI: Probable D,D-dipeptide transport ATP-binding protein DdpD (ddpD) from Escherichia coli (strain K12)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to eco:b1484)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2); Putative hemine transporter ATP-binding subunit" (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>OHPLBJKB_02233 putative D,D-dipeptide transport ATP-binding protein DdpD (Escherichia coli HS(pFamp)R (ATCC 700891))
MTQPVLDIQQLHLSFPGFNGDVHALNNVSLQINRGEIVGLVGESGSGKSVTAMLIMRLLP
TGSYCVHRGQISLLGEDVLNAREKQLRQWRGARVAMIFQEPMTALNPTRRIGLQMMDVIR
HHQPISRREARAKAIALLEEMQIPDAVEVMSRYPFELSGGMRQRVMIALAFSCEPQLIIA
DEPTTALDVTVQLQVLRLLKHKARASGTAVLFISHDMAVVSQLCDSVYVMYAGSVIESGV
TADVIHHPRHPYTIGLLQCAPEHGVPRQLLPAIPGTVPNLTHLPDGCAFRDRCYAAGAQC
ENVPALTACGDNNQRCACWYPQQEVISV