Protein Info for OHPLBJKB_02208 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Autoinducer-2 kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 PF00370: FGGY_N" amino acids 13 to 260 (248 residues), 167.6 bits, see alignment E=3.8e-53 PF02782: FGGY_C" amino acids 298 to 467 (170 residues), 66.7 bits, see alignment E=2.6e-22

Best Hits

Swiss-Prot: 100% identical to LSRK_ECOHS: Autoinducer-2 kinase (lsrK) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K11216, autoinducer 2 (AI-2) kinase [EC: 2.7.1.-] (inferred from 100% identity to ecx:EcHS_A1593)

MetaCyc: 99% identical to autoinducer-2 kinase (Escherichia coli K-12 substr. MG1655)
RXN0-5461 [EC: 2.7.1.189]

Predicted SEED Role

"Autoinducer 2 (AI-2) kinase LsrK (EC 2.7.1.-)" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.189

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (530 amino acids)

>OHPLBJKB_02208 Autoinducer-2 kinase (Escherichia coli HS(pFamp)R (ATCC 700891))
MARLFTPSESKYYLMALDAGTGSIRAVIFDLEGNQIAVGQAEWRHLAVPDVPGSMEFDLN
KNWQLACECMRQALHNAGIAPEYIAAVSACSMREGIVLYNNEGTPIWACANVDARAAREV
SELKELHNNTFENEVYRATGQTLALSAIPRLLWLAHHRSDIYRQASTITMISDWLAYMLS
GELAVDPSNAGTTGLLDLTTRDWKPALLDMAGLRADILSPVKETGTLLGVVSSQAAELCG
LKAGTPVVVGGGDVQLGCLGLGVVRPAQTAVLGGTFWQQVVNLAAPVTDPEMNVRVNPHV
IPGMVQAESISFFTGLTMRWFRDAFCAEEKLIAERLGIDTYTLLEEMTSRVPPGSWGVMP
IFSDRMRFKTWYHAAPSFINLSIDPDKCNKATLFRALEENAAIVSACNLQQIADFSNIHP
SSLVFAGGGSKGKLWSQILADVSGLPVNIPVVKEATALGCAIAAGVGAGIFSSMAETGER
LVRWERTHTPAPEKHELYQDSRDKWQAVYQDQLGLVDHGLTTSLWKAPGL