Protein Info for OHPLBJKB_02191 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Sugar efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 350 (333 residues), 132 bits, see alignment E=1.3e-42

Best Hits

Swiss-Prot: 100% identical to SOTB_ECOHS: Probable sugar efflux transporter (sotB) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K08159, MFS transporter, DHA1 family, L-arabinose/isopropyl-beta-D-thiogalactopyranoside export protein (inferred from 100% identity to eco:b1528)

MetaCyc: 100% identical to L-arabinose exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-40

Predicted SEED Role

"Sugar efflux transporter SotB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>OHPLBJKB_02191 Sugar efflux transporter (Escherichia coli HS(pFamp)R (ATCC 700891))
MTTNTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWV
VALMSLPFMLMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWS
ITASLAIRMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGALIT
LLCLIKLLPLLPSEHSGSLKSLPLLFRRPALMSIYLLTVVVVTAHYTAYSYIEPFVQNIA
GFSANFATALLLLLGGAGIIGSVIFGKLGNQYASALVSTAIALLLVCLALLLPAANSEIH
LGVLSIFWGIAMMIIGLGMQVKVLALAPDATDVAMALFSGIFNIGIGAGALVGNQVSLHW
SMSMIGYVGAVPAFAALIWSIIIFRRWPVTLEEQTQ