Protein Info for OHPLBJKB_02079 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Superoxide dismutase [Cu-Zn]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00080: Sod_Cu
  • amino acids 39 to 172 (134 residues), 114.9 bits, E=1.8e-37

Best Hits

Swiss-Prot: 100% identical to SODC_ECOLI: Superoxide dismutase [Cu-Zn] (sodC) from Escherichia coli (strain K12)

KEGG orthology group: K04565, Cu/Zn superoxide dismutase [EC: 1.15.1.1] (inferred from 100% identity to eco:b1646)

MetaCyc: 100% identical to superoxide dismutase (Cu-Zn) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Cu-Zn] precursor (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• ethene biosynthesis III (microbes) (6/7 steps found)
• superoxide radicals degradation (2/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (173 amino acids)

>OHPLBJKB_02079 Superoxide dismutase [Cu-Zn] (Escherichia coli HS(pFamp)R (ATCC 700891))
MKRFSLAILALVVATGAQAASEKVEMNLVTSQGVGQSIGSVTITETDKGLEFSPDLKALP
PGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQNTGKHEGPEGAGHLGDLPALVVNN
DGKATDAVIAPRLKSLDEIKDKALMVHVGGDNMSDQPKPLGGGGERYACGVIK