Protein Info for OHPLBJKB_02008 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF03881: Fructosamin_kin" amino acids 1 to 285 (285 residues), 390.2 bits, see alignment E=5.8e-121 PF01636: APH" amino acids 24 to 239 (216 residues), 66.7 bits, see alignment E=2.8e-22

Best Hits

Swiss-Prot: 100% identical to YNIA_ECO57: Putative kinase YniA (yniA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to eco:b1725)

Predicted SEED Role

"Ribulosamine/erythrulosamine 3-kinase potentially involved in protein deglycation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>OHPLBJKB_02008 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MWQAISRLLSEQLGEGEIELRNELPGGEVHAAWHLRYAGHDFFVKCDERELLPGFTAEAD
QLELLSRSKTVTVPKVWAVGADRDYSFLVMDYLPPRPLDAHSAFILGQQIARLHQWSDQP
QFGLDFDNSLSTTPQPNTWQRRWSTFFAEQRIGWQLELAAEKGIAFGNIDAIVEHIQQRL
ASHQPQPSLLHGDLWSSNCALGPDGPYIFDPACYWGDRECDLAMLPLHTEQPPQIYDGYQ
SVSPLPADFLERQPVYQLYTLLNRARLFGGQHLVIAQQSLDRLLAA