Protein Info for OHPLBJKB_01951 in Escherichia coli HS(pFamp)R (ATCC 700891)
Annotation: Glyoxal reductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to YEAE_ECOLI: Uncharacterized protein YeaE (yeaE) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 100% identity to eco:b1781)MetaCyc: 100% identical to methylglyoxal reductase YeaE (Escherichia coli K-12 substr. MG1655)
Aldehyde reductase. [EC: 1.1.1.21]
Predicted SEED Role
"Putative oxidoreductase YeaE, aldo/keto reductase family"
MetaCyc Pathways
- superpathway of methylglyoxal degradation (7/8 steps found)
- methylglyoxal degradation III (2/2 steps found)
- D-arabinose degradation V (1/3 steps found)
- detoxification of reactive carbonyls in chloroplasts (1/10 steps found)
- superpathway of pentose and pentitol degradation (16/42 steps found)
KEGG Metabolic Maps
- Fructose and mannose metabolism
- Galactose metabolism
- Glycerolipid metabolism
- Pentose and glucuronate interconversions
- Pyruvate metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.1.1.21
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (284 amino acids)
>OHPLBJKB_01951 Glyoxal reductase (Escherichia coli HS(pFamp)R (ATCC 700891)) MQQKMIQFSGDVSLPAVGQGTWYMGEDASQRKTEVAALRAGIELGLTLIDTAEMYADGGA EKVVGEALTGLREKVFLVSKVYPWNAGGQKAINACEASLRRLNTDYLDLYLLHWSGSFAF EETVAAMEKLIAQGKIRRWGVSNLDYADMQELWQLPGGNQCATNQVLYHLGSRGIEYDLL PWCQQQQMPVMAYSPLAQAGRLRNGLLKNAVVNEIAHAHNISAAQVLLAWVISHQGVMAI PKAATIAHVQQNAAVLEVELSSAELAMLDKAYPAPKGKTALDMV