Protein Info for OHPLBJKB_01863 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Dihydroneopterin triphosphate diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 27 to 163 (137 residues), 63.6 bits, E=9.7e-22

Best Hits

Swiss-Prot: 99% identical to NUDB_SHIFL: Dihydroneopterin triphosphate diphosphatase (nudB) from Shigella flexneri

KEGG orthology group: K08310, dATP pyrophosphohydrolase [EC: 3.6.1.-] (inferred from 99% identity to ecl:EcolC_1767)

MetaCyc: 99% identical to dihydroneopterin triphosphate diphosphatase (Escherichia coli K-12 substr. MG1655)
3.6.1.M7,3.6.1.9 [EC: 3.6.1.9, 3.6.1.M7]; H2NEOPTERINP3PYROPHOSPHOHYDRO-RXN [EC: 3.6.1.9, 3.6.1.M7, 3.6.1.67]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (3/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (4/5 steps found)
• dZTP biosynthesis (3/5 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.67 or 3.6.1.9 or 3.6.1.M7

Protein Sequence (169 amino acids)

>OHPLBJKB_01863 Dihydroneopterin triphosphate diphosphatase (Escherichia coli HS(pFamp)R (ATCC 700891))
MSIDNYVNGMSEGSQRRGSVKDKVYKRPVSILVVIYAQDTKRVLMLQRRDDPDFWQSVTG
SVEEGETAPQAAMREVKEEVTIDVVAEQLTLIDCQRTVEFEIFSHLRHRYAPGVTRNTES
WFCLALPHERQIVFTEHLAYKWLDAPAAAALTKSWSNRQAIEQFVINAA