Protein Info for OHPLBJKB_01831 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Trehalose-6-phosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00685: trehalose-phosphatase" amino acids 12 to 244 (233 residues), 307.6 bits, see alignment E=8.3e-96 TIGR01484: HAD hydrolase, family IIB" amino acids 18 to 213 (196 residues), 73.9 bits, see alignment E=2e-24 PF02358: Trehalose_PPase" amino acids 18 to 231 (214 residues), 193 bits, see alignment E=4.4e-61

Best Hits

Swiss-Prot: 100% identical to OTSB_ECOLI: Trehalose-6-phosphate phosphatase (otsB) from Escherichia coli (strain K12)

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 100% identity to eco:b1897)

MetaCyc: 100% identical to trehalose-6-phosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Trehalose-phosphatase. [EC: 3.1.3.12]

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>OHPLBJKB_01831 Trehalose-6-phosphate phosphatase (Escherichia coli HS(pFamp)R (ATCC 700891))
MTEPLTETPELSAKYAWFFDLDGTLAEIKPHPDQVVVPDNILQGLQLLATASDGALALIS
GRSMVELDALAKPYRFPLAGVHGAERRDINGKTHIVHLPDAIARDISVQLHTVIAQYPGA
ELEAKGMAFALHYRQAPQHEDALMTLAQRITQIWPQMALQQGKCVVEIKPRGTSKGEAIA
AFMQEAPFIGRTPVFLGDDLTDESGFAVVNRLGGMSVKIGTGATQASWRLAGVPDVWSWL
EMITTALQQKRENNRSDDYESFSRSI